PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01037034001
Common NameVIT_03s0088g00510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family M-type_MADS
Protein Properties Length: 225aa    MW: 25162.9 Da    PI: 9.7733
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01037034001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.21.9e-222164649
                       HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
             SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                       +sn qvtfskRr g++KKA+EL++LC+ae+a+i+fs+  k+y +
  GSVIVT01037034001 21 ESNLQVTFSKRRSGLFKKASELCTLCGAEIAIIVFSPGKKMYSF 64
                       7899**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.1E-30867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.731868IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.09E-26981IPR002100Transcription factor, MADS-box
CDDcd002653.11E-34980No hitNo description
PRINTSPR004042.2E-181030IPR002100Transcription factor, MADS-box
PfamPF003191.5E-241864IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-183045IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-184566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009960Biological Processendosperm development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MAPTRKSKGR QKVEMTKMTK ESNLQVTFSK RRSGLFKKAS ELCTLCGAEI AIIVFSPGKK  60
MYSFGHPGVE SIIDRFLTGN PLPHSGALQL FEAHRSANVR DLNMQLTQVL NQLEGEKKRG  120
EALTQMKKAS QAQYWWAAPI EELSFEQLEL LKVSLENLKR NVEMHADKHM MEASNPLTFF  180
LSSSVGAGVP YDAHIAAFDP LNFNFGYGGI ISLSKQFENQ NYRT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J3e-15986177Myocyte-specific enhancer factor 2A
3p57_I3e-15986177Myocyte-specific enhancer factor 2A
3p57_D3e-15986177Myocyte-specific enhancer factor 2A
3p57_C3e-15986177Myocyte-specific enhancer factor 2A
3p57_B3e-15986177Myocyte-specific enhancer factor 2A
3p57_A3e-15986177Myocyte-specific enhancer factor 2A
3kov_J3e-15986177Myocyte-specific enhancer factor 2A
3kov_I3e-15986177Myocyte-specific enhancer factor 2A
3kov_B3e-15986177Myocyte-specific enhancer factor 2A
3kov_A3e-15986177Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4753360.0AM475336.2 Vitis vinifera contig VV78X173329.6, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002271290.11e-156PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK22e-68AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLD7T3N51e-168D7T3N5_VITVI; Putative uncharacterized protein
STRINGVIT_03s0088g00510.t011e-168(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-69AGAMOUS-like 62